PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G144000.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family VOZ
Protein Properties Length: 549aa    MW: 61670.8 Da    PI: 5.9403
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G144000.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ427.71.7e-1312534701217
                 VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalne.glpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspw 90 
                         p+p+afl+pkcalwdc+rpaqgse++qdycs++ha+la++e g+pgt+pv+rp+gidlkdg+lfaalsak+qgk+vgip+cegaatakspw
  Brast01G144000.2.p 253 PAPAAFLRPKCALWDCPRPAQGSERWQDYCSMYHAELAVKEeGPPGTMPVIRPRGIDLKDGPLFAALSAKIQGKHVGIPVCEGAATAKSPW 343
                         89*************************************9879************************************************ PP

                 VOZ  91 naaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldala 181
                         na+elfdl ++ege+irewlffdkprrafesgnrkqrslpdy grgwhesrkqvmk+fgglkrsyymdpqpsss+ewhlyeyein++da+a
  Brast01G144000.2.p 344 NAPELFDLYIFEGESIREWLFFDKPRRAFESGNRKQRSLPDYGGRGWHESRKQVMKDFGGLKRSYYMDPQPSSSYEWHLYEYEINDCDAFA 434
                         ******************************************************************************************* PP

                 VOZ 182 lyrlelklvdekksakgkvskdsladlqkklgrlta 217
                         lyrle+k++d+kk+ak+k++++sl+++q++++rl+a
  Brast01G144000.2.p 435 LYRLEFKSSDAKKNAKSKLACNSLNEIQQQMVRLSA 470
                         **********************************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 549 aa     Download sequence    Send to blast
MRKGSSRSGS ARHQQFRARA KTRVDDLQEM FSGLQYARKE ARSTDAVVLE AQLHQMLREW  60
RAELSAPSPA SSLQGNNREL SDPPSETLRL LQLAAAEEED DATSKLVEQQ PPSSANQAHK  120
HAQAVQDMKP EPREEVAPSV MVAQQPPSLG QGVMTTGGGM PTPATAVFHD QMYYVNQELT  180
VEDFLYGDDY KINLPGSNPD VHSNLEGIGH MEYPQFNLPQ ELPSNVYIDM NNYGQNAGDV  240
FLHMSDLLTT MSPAPAAFLR PKCALWDCPR PAQGSERWQD YCSMYHAELA VKEEGPPGTM  300
PVIRPRGIDL KDGPLFAALS AKIQGKHVGI PVCEGAATAK SPWNAPELFD LYIFEGESIR  360
EWLFFDKPRR AFESGNRKQR SLPDYGGRGW HESRKQVMKD FGGLKRSYYM DPQPSSSYEW  420
HLYEYEINDC DAFALYRLEF KSSDAKKNAK SKLACNSLNE IQQQMVRLSA DSPVENKRAA  480
RARTKDVSTN IYSVQNNTIQ ANDPNAYQRV SQVDQMTYLN GNVVYGPHLP YGYSTERSDF  540
YWNSNDRA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2417650.0AK241765.1 Oryza sativa Japonica Group cDNA, clone: J065205E23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003569827.10.0PREDICTED: transcription factor VOZ1
SwissprotQ9SGQ01e-158VOZ1_ARATH; Transcription factor VOZ1
TrEMBLI1HRM90.0I1HRM9_BRADI; Uncharacterized protein
STRINGBRADI2G50070.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-121vascular plant one zinc finger protein